DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4G1 and wu:fb16f03

DIOPT Version :9

Sequence 1:NP_001096852.1 Gene:eIF4G1 / 43839 FlyBaseID:FBgn0023213 Length:1919 Species:Drosophila melanogaster
Sequence 2:XP_017206776.1 Gene:wu:fb16f03 / 100006548 ZFINID:ZDB-GENE-030131-196 Length:456 Species:Danio rerio


Alignment Length:491 Identity:130/491 - (26%)
Similarity:206/491 - (41%) Gaps:59/491 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1436 DRSGPRNKGSYNKGSMERDRYDRGMHSRTGSSQGSRENSSSRGGQQGRTLLSSSVQKSTSHSKYT 1500
            ||:|.|.:|...:|| :|:|...|..|   .|:...|.|..|..||.    ||.|.:..| |..|
Zfish     2 DRAGDRYEGRDERGS-DRNRPAVGKRS---FSREKEERSREREQQQH----SSEVLRRGS-STTT 57

  Fly  1501 QQAPPTRHTVKAQSSVGSSNVNTGPLYRGSEQQTSATFSQTTRSVAPVAVFIEASETDLKLIKSV 1565
            ......|...:.:|:...|...|.|....:.:..........:|.|.:..::..:  |||.....
Zfish    58 DHRERDRERERERSAKRESVAATPPPPAAASKPALTEEELEKKSTAIIEEYLHIN--DLKEALQC 120

  Fly  1566 VSEIVDLSAASKEVTPGAVSCIKRVPEKLRCSFIYYILTDYLHLANVGKQYRRYLSIAVSQLIQQ 1630
            |||:...|..|..|..|..|.::|..                 ||      |.:|.:...||::.
Zfish   121 VSELNCSSLLSVFVRTGIESTLERST-----------------LA------REHLGLLFHQLLKT 162

  Fly  1631 NYISADHLRLAYNEFTVYANDLIVDIPELWLYILQFAGPLIVKKILTISDLWNNNLKENSPSNVA 1695
            ..::.........|....|.|:.:|||.:|||:.:...|::.:..:.:..|:....|...|...|
Zfish   163 QTLTTQQYYKGLMEVLEVAEDMAIDIPHIWLYLAELICPMLHEGGIPMGPLFRELSKPLLPLGKA 227

  Fly  1696 KKFLKTYLIYCTQEVGPNFARNMWIKFNLKWSDFMP-ESEVADFIKFNRLEY-------VENESK 1752
            ...|...|....:.:....|..||.:..|.|.:|:| :.:|..|:....:|:       |...||
Zfish   228 GVLLVEILKQLCKGMSHKKAGVMWREAGLNWREFLPDDQDVNKFVTEQAVEFTVLGEESVFEGSK 292

  Fly  1753 SPVIDHRETPEKHVKNVIDHIEHLLKEGTTADCIIDYSNGNI---MVVDKLFIRGLTETLSNFSI 1814
            |.:...:.:.|         :|.||:|......|:|:...|:   .....:.:|.|..::...||
Zfish   293 SSLSPAQISAE---------LERLLQEKADNQRILDWLEANLDEQQATSNMLVRVLMTSVCQSSI 348

  Fly  1815 HYKDNSYKLESETFQKFCIPVLQRYIDSNEDHQLECLYTLQLLVHGLEHPRGLLSELIGELYDAF 1879
             ..||.||::::...:.. .:||||| .:|..:|:.||.||.|:..:|.|..||......|||..
Zfish   349 -ICDNPYKVDTKEMSQRA-KLLQRYI-KDEQKELQALYALQALMVQMEQPPNLLRMFFDVLYDED 410

  Fly  1880 VIQKESLCKWRDSKD--QSAGKGVAVKSLNPFFNSL 1913
            ||::|...:|..|||  :..|||||:||:..||..|
Zfish   411 VIKEEGFYRWESSKDPAEQQGKGVALKSVTAFFTWL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4G1NP_001096852.1 MIF4G 1004..1252 CDD:280935
MA3 1562..1677 CDD:280933 25/114 (22%)
W2_eIF4G1_like 1764..1895 CDD:211397 41/135 (30%)
wu:fb16f03XP_017206776.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11343
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001079
OrthoInspector 1 1.000 - - otm24848
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.