DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mGluR and Gprc5d

DIOPT Version :9

Sequence 1:NP_001259076.1 Gene:mGluR / 43838 FlyBaseID:FBgn0019985 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001192325.1 Gene:Gprc5d / 93746 MGIID:1935037 Length:344 Species:Mus musculus


Alignment Length:272 Identity:58/272 - (21%)
Similarity:112/272 - (41%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 FALIPMAIAIFGIALTSIVIVLF----AKNHDTPLVRASGRELSYTL----LFGILVCYCNTFAL 682
            :|::..::|:.||.:|.::::.|    .|..|.........:..:.|    |||:      |||.
Mouse    22 WAIVLESLAVIGIVVTILLLLAFLFLMRKVQDCSQWNVLPTQFLFLLAVLGLFGL------TFAF 80

  Fly   683 IAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISRIFHSASKSAQRLKYISPQSQVVITTSL-- 745
            |.:....:..::.|..||.|:|.:|.||...:.:             :|.:..:.....||.|  
Mouse    81 IIQLNHQTAPVRYFLFGVLFAICFSCLLAHASNL-------------VKLVRGRVSFCWTTILFI 132

  Fly   746 -IAIQVLITMIWM----VVEPPGTRFYY--PDRREVILKCKIQDMSFLFSQLYNMILITICTIYA 803
             |.:.:|.|:|.:    ::...|..|.:  |.:..|...|.:..:.||.:..:.:...|.|.   
Mouse   133 AIGVSLLQTIIAIEYVTLIMTRGLMFEHMTPYQLNVDFVCLLIYVLFLMALTFFVSKATFCG--- 194

  Fly   804 IKTRKIP-ENFNE-SKFIGFTMYTTCIIWLAFVPIYFGTGNSYEVQ----TTTLCISISLSASVA 862
                  | ||:.: .:.|..|:..:.|||:.::.:........:.|    ...:||.:..:|.|.
Mouse   195 ------PCENWKQHGRLIFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDAVICIGLVTNAWVF 253

  Fly   863 LVCLYSPKVYIL 874
            |:....|::.||
Mouse   254 LLIYIIPELSIL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mGluRNP_001259076.1 Periplasmic_Binding_Protein_Type_1 43..542 CDD:299141
ANF_receptor 72..518 CDD:279440
NCD3G 557..604 CDD:284890
7tm_3 638..873 CDD:278433 53/257 (21%)
Gprc5dNP_001192325.1 7tm_3 61..264 CDD:278433 48/230 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.