DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mGluR and GPRC5A

DIOPT Version :9

Sequence 1:NP_001259076.1 Gene:mGluR / 43838 FlyBaseID:FBgn0019985 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_003970.1 Gene:GPRC5A / 9052 HGNCID:9836 Length:357 Species:Homo sapiens


Alignment Length:298 Identity:61/298 - (20%)
Similarity:106/298 - (35%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 CGPGLWPYADKLSCYALDIQYMKWNSLFALIPMAIAIFGIALTSIVIVLFAKNHDTPLVRASGRE 663
            |..||     |...|.|..:...|..:...:..|..:..:|....:.:|..|..|:.  |.....
Human     9 CRNGL-----KSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN--RRKMLP 66

  Fly   664 LSYTLLFGILVCYCNTFALI------AKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISRIFHS 722
            ..:..|.|:|..:..|||.|      ..||      :.|..|:.|||.:|.||.....::::...
Human    67 TQFLFLLGVLGIFGLTFAFIIGLDGSTGPT------RFFLFGILFSICFSCLLAHAVSLTKLVRG 125

  Fly   723 ASKSAQRLKYISPQSQVVI---------TTSLIAIQ-VLITM------IWMVVEPPGTRFYYPDR 771
            .          .|.|.:||         ...:|||: :::||      ::..:..|        |
Human   126 R----------KPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAP--------R 172

  Fly   772 REVILKCKIQDMSFLFSQLYNMILITICTIYAIKTRKIPENFNESKFIGFTMYTTCIIWLAFVPI 836
            |.......:..:.||.:..:.|...|.|..:....|       ....|..||..:..||:|::.:
Human   173 RNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKR-------HGAHIYLTMLLSIAIWVAWITL 230

  Fly   837 YFGTGNSYEVQTTTLCISISLSASVALVCLYSPKVYIL 874
            ............|.|..:::.:..|.|:...||:.::|
Human   231 LMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mGluRNP_001259076.1 Periplasmic_Binding_Protein_Type_1 43..542 CDD:299141
ANF_receptor 72..518 CDD:279440
NCD3G 557..604 CDD:284890 2/4 (50%)
7tm_3 638..873 CDD:278433 52/256 (20%)
GPRC5ANP_003970.1 7tmC_RAIG1_4_GPRC5A_D 26..270 CDD:320406 55/276 (20%)
TM helix 1 27..51 CDD:320406 3/23 (13%)
TM helix 2 65..86 CDD:320406 6/20 (30%)
TM helix 3 95..117 CDD:320406 10/27 (37%)
TM helix 4 136..152 CDD:320406 3/15 (20%)
TM helix 5 173..196 CDD:320406 4/22 (18%)
TM helix 6 210..232 CDD:320406 6/21 (29%)
TM helix 7 239..264 CDD:320406 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.