DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mGluR and Gprc5b

DIOPT Version :9

Sequence 1:NP_001259076.1 Gene:mGluR / 43838 FlyBaseID:FBgn0019985 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001182703.1 Gene:Gprc5b / 64297 MGIID:1927596 Length:411 Species:Mus musculus


Alignment Length:302 Identity:69/302 - (22%)
Similarity:136/302 - (45%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 TCKDCGPGLWPYADKLSCYALDIQYMK---WNSLFALIPMAIAIFGIALTSIVIVLFAKNHDTPL 656
            |.:.||..|.|            ||:.   .::::.::..|:|..|..:|.:::::....  .|.
Mouse    33 TSRGCGLDLLP------------QYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVR--LPF 83

  Fly   657 VRASGRE----LSYTLLFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRIS 717
            ::...|:    |.:..|.|.|..:..|||.|.:.....|.::||..||.|::.:|.||::..|:.
Mouse    84 IKDKERKRPVCLHFLFLLGTLGLFGLTFAFIIQMDETICSIRRFLWGVLFALCFSCLLSQAWRVR 148

  Fly   718 RIFHSASKSAQRLKYISPQSQVVITTS--LIAIQVLITMIWMVVEPPGTRFYYPDRREVILKCKI 780
            |:....:         ||.|..:::.:  |:.:||:|...|:|:..         .|:....|..
Mouse   149 RLVRQGT---------SPASWQLVSLALCLMLVQVIIATEWLVLTV---------LRDTKPACAY 195

  Fly   781 QDMSFLFSQLYNMILITICTIYAIKTRKIPENFNESK----FIGFTMYTTCIIWLAFVPIYFGTG 841
            :.|.|:.:.:|:|:|:.|....::.|  :...|...|    ||..|.:.:.:||:.::.:|. .|
Mouse   196 EPMDFVMALIYDMVLLAITLAQSLFT--LCGKFKRWKVNGAFILVTTFLSALIWVVWMTMYL-FG 257

  Fly   842 NSYEVQ-----TTTLCISISLSASVALVCLYSPKVYILVFHP 878
            ||...|     ..||.|:::.|..|.::....|:::..:..|
Mouse   258 NSLIKQGDAWSDPTLAITLAASGWVFVIFHAIPEIHYTLLPP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mGluRNP_001259076.1 Periplasmic_Binding_Protein_Type_1 43..542 CDD:299141
ANF_receptor 72..518 CDD:279440
NCD3G 557..604 CDD:284890 3/8 (38%)
7tm_3 638..873 CDD:278433 58/249 (23%)
Gprc5bNP_001182703.1 7tm_3 <112..293 CDD:278433 49/201 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.