DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mGluR and GPRC5D

DIOPT Version :9

Sequence 1:NP_001259076.1 Gene:mGluR / 43838 FlyBaseID:FBgn0019985 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_061124.1 Gene:GPRC5D / 55507 HGNCID:13310 Length:345 Species:Homo sapiens


Alignment Length:380 Identity:83/380 - (21%)
Similarity:151/380 - (39%) Gaps:74/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 KDCGPGLWPYADKLSCYALDIQYMKWNSLFALIPMAIAIFGIALTSIVIVLF----AKNHDTPLV 657
            |||......|.  |.|.|        ...:.:|..::||.||.:|.::::.|    .|..|....
Human     3 KDCIESTGDYF--LLCDA--------EGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQW 57

  Fly   658 RASGRELSYTL----LFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISR 718
            .....:|.:.|    |||:      .||.|.:....:..::.|..||.|::.:|.||...:.:.:
Human    58 NVLPTQLLFLLSVLGLFGL------AFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVK 116

  Fly   719 IFHS-ASKSAQRLKYIS---PQSQVVITTSLIAIQVLITMIWMVVEPPGTRFYYPDRREVILKCK 779
            :... .|.|...:..|:   ...|::|.|..:.:.:...|:::.:.|                |:
Human   117 LVRGCVSFSWTTILCIAIGCSLLQIIIATEYVTLIMTRGMMFVNMTP----------------CQ 165

  Fly   780 IQDMSFLFSQLYNMILITICTIYAIKTRKIP-ENFNE-SKFIGFTMYTTCIIWLAFVPIYFGTGN 842
            : ::.|:...:|.:.|:.:....:..|...| ||:.: .:.|..|:..:.|||:.::.:......
Human   166 L-NVDFVVLLVYVLFLMALTFFVSKATFCGPCENWKQHGRLIFITVLFSIIIWVVWISMLLRGNP 229

  Fly   843 SYEVQ----TTTLCISISLSASVALVCLYSPKVYILVFHPDKNVRKLTMNS---TVYRRSAAAVA 900
            .::.|    ...:||::..:|.|.|:....|::.|| :...:....|..|:   |.|:.|.....
Human   230 QFQRQPQWDDPVVCIALVTNAWVFLLLYIVPELCIL-YRSCRQECPLQGNACPVTAYQHSFQVEN 293

  Fly   901 Q---GAPTSSGYSRTHAPGTSALTGGAVGTNASSSTL-PTQN--------SPHLD 943
            |   .|..|.|     |....|||  :.||.....|: |||.        ||..|
Human   294 QELSRARDSDG-----AEEDVALT--SYGTPIQPQTVDPTQECFIPQAKLSPQQD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mGluRNP_001259076.1 Periplasmic_Binding_Protein_Type_1 43..542 CDD:299141
ANF_receptor 72..518 CDD:279440
NCD3G 557..604 CDD:284890 3/6 (50%)
7tm_3 638..873 CDD:278433 48/252 (19%)
GPRC5DNP_061124.1 7tm_GPCRs 21..267 CDD:333717 54/269 (20%)
TM helix 1 22..46 CDD:320095 7/23 (30%)
TM helix 2 60..81 CDD:320095 7/26 (27%)
TM helix 3 90..112 CDD:320095 7/21 (33%)
TM helix 4 131..147 CDD:320095 4/15 (27%)
TM helix 5 166..189 CDD:320095 3/23 (13%)
TM helix 6 200..225 CDD:320095 5/24 (21%)
TM helix 7 236..261 CDD:320095 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.