DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mGluR and Vmn2r62

DIOPT Version :10

Sequence 1:NP_524639.2 Gene:mGluR / 43838 FlyBaseID:FBgn0019985 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001098529.1 Gene:Vmn2r62 / 546964 MGIID:3757994 Length:859 Species:Mus musculus


Alignment Length:113 Identity:25/113 - (22%)
Similarity:45/113 - (39%) Gaps:29/113 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRLGRQLSMSKKQLEEWSQNSKEVMYNGCLEKFSQNNVCRENLFRTHGMRLVEASPMDRIWGIGL 146
            :.:|.:.|.||       :..|:.:.|.||    .:..|||...|    .:.:.|        |.
Mouse   646 RAVGVKPSCSK-------EPPKQCLSNPCL----NSGTCREGWNR----YVCDCS--------GT 687

  Fly   147 SHHDKRCENEQT---WRGTNWMGSVLDKVREELWTKSEYQQLRLEIEK 191
            .:..:.||.:.|   :.|:.:|...|..|   :.|::|...||...::
Mouse   688 GYLGRSCERDATILSYDGSKFMKIQLPVV---MHTEAEDVSLRFRSQR 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mGluRNP_524639.2 PBP1_mGluR_groupII 39..542 CDD:380598 25/113 (22%)
NCD3G 556..605 CDD:462210
7tmC_mGluRs_group2_3 625..876 CDD:320600
TM helix 1 625..650 CDD:320600
TM helix 2 662..683 CDD:320600
TM helix 3 692..716 CDD:320600
TM helix 4 738..758 CDD:320600
TM helix 5 781..807 CDD:320600
TM helix 6 815..838 CDD:320600
TM helix 7 845..870 CDD:320600
Vmn2r62NP_001098529.1 PBP1_pheromone_receptor 40..506 CDD:380588
NCD3G 514..567 CDD:462210
7tmC_V2R_pheromone 587..838 CDD:320410 25/113 (22%)
TM helix 1 587..612 CDD:320410
TM helix 2 624..645 CDD:320410
TM helix 3 654..678 CDD:320410 9/34 (26%)
TM helix 4 702..718 CDD:320410 4/18 (22%)
TM helix 5 745..771 CDD:320410
TM helix 6 779..802 CDD:320410
TM helix 7 807..832 CDD:320410
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.