DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and PDLIM1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:285 Identity:60/285 - (21%)
Similarity:99/285 - (34%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GDEDSQMRLRLKRKLQRNRTSFSNEQIDSL------EKEFERTHYPDVFARERL---ADKIGLPE 306
            |.:|.:..|.:.|....::.:.:|..|..:      |.....||   :.|:.|:   .|.:.|..
Human    20 GGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTH---LEAQNRIKGCTDNLTLTV 81

  Fly   307 ARIQ--VW--FSNRRAKWRREEKMR-------------TQRRSADTVDGSGRTSTA--------N 346
            ||.:  ||  ......| |...||.             ...|||.....|..:||.        |
Human    82 ARSEHKVWSPLVTEEGK-RHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVITNQYN 145

  Fly   347 NPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLP-EASNGPT--VLGGEANTTHTSS 408
            ||:|..:|.:::..||:..         ::..:|.:.:||.| :.:..|:  |:..|:.......
Human   146 NPAGLYSSENISNFNNALE---------SKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQ 201

  Fly   409 E-----SPPLQPAA---------------PRLPLNSGFNTMYSSIPQPIATMAENYNSSLGS--M 451
            |     .||.|..:               |..|  |||.    |:..|:..:|    :|:|:  .
Human   202 EKQELNEPPKQSTSFLVLQEILESEEKGDPNKP--SGFR----SVKAPVTKVA----ASIGNAQK 256

  Fly   452 TPSC-------------LQQRDAYP 463
            .|.|             |:.|..:|
Human   257 LPMCDKCGTGIVGVFVKLRDRHRHP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/148 (22%)
Homeobox 269..322 CDD:395001 14/65 (22%)
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492 13/64 (20%)
DUF4749 138..230 CDD:318205 18/100 (18%)
LIM_CLP36 260..311 CDD:188832 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.