DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and YHP1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:394 Identity:82/394 - (20%)
Similarity:134/394 - (34%) Gaps:138/394 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PLPDSTR--QKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVAT-- 105
            ||..|..  :.:|.:..|   |||..|..:.|                  |:|:.....||.|  
Yeast    45 PLAASAHIVRPVVNIYKS---PCDEERPKRKS------------------PQAVDFLSQRVTTSM 88

  Fly   106 TPV--VQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNE 168
            ||:  .:|::.:....|::            :||:                    |||..|..:.
Yeast    89 TPLSKPKKLSSHSPFTPTV------------RVCS--------------------KEQPPQSMHS 121

  Fly   169 SVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSH 233
              |:|:.:                   ||...||..|.:|..      |.: :||...|   ::|
Yeast   122 --YKKVNI-------------------LTPLSAAKAVLTPTT------RKE-KKRSFAF---ITH 155

  Fly   234 TNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERL 298
                       |:......|......||.|:.:|..:|:   ::..|:..|:....|:...|..|
Yeast   156 -----------SQETFPKKEPKIDNARLARRKRRRTSSY---ELGILQTAFDECPTPNKAKRIEL 206

  Fly   299 ADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTS----TANNPSGTTASSSVAT 359
            :::..:.|..:|:||.|:             |::|.....||.||    .:|:.....:.|..|.
Yeast   207 SEQCNMSEKSVQIWFQNK-------------RQAAKKHKNSGNTSHCKVHSNDSMSMISYSDAAL 258

  Fly   360 SNNSTPGIVNSAINVAE--RTSSALVSNSLPEASNGPTVLGGE--------------ANTTHTSS 408
            ...|||.....|| .||  :||.|..|:...:....|...||:              :||.|:..
Yeast   259 EITSTPTSTKEAI-TAELLKTSPANTSSIFEDHHITPCKPGGQLKFHRKSVLVKRTLSNTGHSEI 322

  Fly   409 ESPP 412
            ...|
Yeast   323 IKSP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 21/113 (19%)
COG5576 <253..368 CDD:227863 28/118 (24%)
Homeobox 269..322 CDD:395001 11/52 (21%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 45/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.