DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and PHV

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_174337.1 Gene:PHV / 839928 AraportID:AT1G30490 Length:841 Species:Arabidopsis thaliana


Alignment Length:487 Identity:90/487 - (18%)
Similarity:144/487 - (29%) Gaps:215/487 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 HNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADK----IGLPEA 307
            |:|..|.||..:.....|..|    ::.||:::||:.:.....|....|::|..:    ..:...
plant     4 HHSMDDRDSPDKGFDSGKYVR----YTPEQVEALERVYAECPKPSSLRRQQLIRECPILCNIEPR 64

  Fly   308 RIQVWFSNRRAKWRR----------------------EEKMRTQRRSADTVDGSG----RTSTAN 346
            :|:|||.|||.:.::                      ||..|.|::.::.|..:|    |..|| 
plant    65 QIKVWFQNRRCREKQRKESARLQTVNRKLSAMNKLLMEENDRLQKQVSNLVYENGFMKHRIHTA- 128

  Fly   347 NPSGTTASSSV--------------ATSNNSTPGIVNSA--INVAERT----------------- 378
              ||||..:|.              .|..:....:.|.|  :::||.|                 
plant   129 --SGTTTDNSCESVVVSGQQRQQQNPTHQHPQRDVNNPANLLSIAEETLAEFLCKATGTAVDWVQ 191

  Fly   379 --------------------------SSALVS--------------------------NSLPEAS 391
                                      :..|||                          |.:|..:
plant   192 MIGMKPGPDSIGIVAVSRNCSGIAARACGLVSLEPMKVAEILKDRPSWFRDCRCVETLNVIPTGN 256

  Fly   392 NG-----------PTVLGGEAN----------------------TTHTSSESPPLQPAAPRLP-L 422
            .|           ||.|....:                      |:.|...:.||..:..|.. |
plant   257 GGTIELVNTQIYAPTTLAAARDFWTLRYSTSLEDGSYVVCERSLTSATGGPNGPLSSSFVRAKML 321

  Fly   423 NSGF------------------NTMYSSIPQPIATMAENYNSSLGSMTPSCLQ------------ 457
            :|||                  :...||:|:.:..:.|:.......||.:.|:            
plant   322 SSGFLIRPCDGGGSIIHIVDHVDLDVSSVPEVLRPLYESSKILAQKMTVAALRHVRQIAQETSGE 386

  Fly   458 ------QRDAYPYMFHDPLSLG-------------SPYVS--AHHRNTACNPSAAHQQPPQHGVY 501
                  ::.|....|...|..|             ||..|  ........|.|:|.....|:|  
plant   387 VQYSGGRQPAVLRTFSQRLCRGFNDAVNGFVDDGWSPMSSDGGEDITIMINSSSAKFAGSQYG-- 449

  Fly   502 TNSSPMPSSNTGVISAGVSVPVQISTQNVSDL 533
              ||.:||..:||:.|..|:.:    |||..|
plant   450 --SSFLPSFGSGVLCAKASMLL----QNVPPL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/158 (21%)
Homeobox 269..322 CDD:395001 14/56 (25%)
PHVNP_174337.1 Homeobox 21..78 CDD:278475 16/60 (27%)
bZIP <73..112 CDD:269834 6/38 (16%)
START_ArGLABRA2_like 164..380 CDD:176884 29/215 (13%)
MEKHLA 693..836 CDD:285833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.