DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and MIXL1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:245 Identity:69/245 - (28%)
Similarity:93/245 - (37%) Gaps:61/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSE 246
            ||....|.:...|.|..|||.   ..||..:|...||.........|:      ...:...|.:.
Human    26 GGALLPPPSPAAALLPAPPAG---PGPATFAGFLGRDPGPAPPPPASL------GSPAPPKGAAA 81

  Fly   247 HNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARI-- 309
            .::|              .:|.|||||.||:..||..|.||.|||:..|||||....|||:||  
Human    82 PSAS--------------QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQL 132

  Fly   310 ------QVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIV 368
                  ||||.|||||.||:               ||:       |....:......|:..||..
Human   133 LFSPLFQVWFQNRRAKSRRQ---------------SGK-------SFQPLARPEIILNHCAPGTE 175

  Fly   369 NSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAP 418
            ...:.  .:....:..|.|||    |..:||  ..:.:||:....:..:|
Human   176 TKCLK--PQLPLEVDVNCLPE----PNGVGG--GISDSSSQGQNFETCSP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 43/122 (35%)
Homeobox 269..322 CDD:395001 34/60 (57%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 34/60 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.