DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HB53

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:210 Identity:56/210 - (26%)
Similarity:86/210 - (40%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TSPAN--------LSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLK 262
            |.|.|        :.|..:...|::|..:.|...|.||..|....|.             .|| |
plant    22 TQPQNSHCIIVNQIDGGEESKPVKRRRKRRSKGSSATNEEDVAEIGG-------------MLR-K 72

  Fly   263 RKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRR---EE 324
            |||       ::||::.||..|...|..:...:|::|.::||...::.|||.||||:|:.   ||
plant    73 RKL-------TDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEE 130

  Fly   325 KMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPE 389
            :....:...|.| ..|:....:.....|...|.|.|.     |...:..:.|..:::..|:...|
plant   131 EYAKLKNHHDNV-VLGQCQLESQILKLTEQLSEAQSE-----IRKLSERLEEMPTNSSSSSLSVE 189

  Fly   390 ASNGPT--VLGGEAN 402
            |:|.||  .|..|.|
plant   190 ANNAPTDFELAPETN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/117 (28%)
Homeodomain 267..322 CDD:459649 18/54 (33%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 23/61 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.