DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HB40

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:182 Identity:47/182 - (25%)
Similarity:73/182 - (40%) Gaps:55/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 DVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKE 283
            ||..:.:|...||.........:.|     |....|....|..||||       ::||::.||..
plant    19 DVYTQIVQPVGEVKQPKRRRKKTKG-----SVASADGGNGLFRKRKL-------TDEQVNMLEMS 71

  Fly   284 FERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRRE------------------EKMRTQ- 329
            |...|..:...::|||.::||...::.|||.||||:|:.:                  :|.|.: 
plant    72 FGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEEYNKLKNSHDNVVVDKCRLES 136

  Fly   330 ----------------RRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTP 365
                            :|.|:.|:|    .::|:|    .||||:...|.||
plant   137 EVIQLKEQLYDAEREIQRLAERVEG----GSSNSP----ISSSVSVEANETP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 40/148 (27%)
Homeodomain 267..322 CDD:459649 19/54 (35%)
HB40NP_001329011.1 HOX 56..109 CDD:197696 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.