DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HB20

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:277 Identity:62/277 - (22%)
Similarity:99/277 - (35%) Gaps:73/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 HDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADK 301
            |:.|.|   |.|.|.|....|....|::||.       ||:.:|||.||..:..:...:.:||..
plant    66 HNQTLD---EENLSDDGAHTMLGEKKKRLQL-------EQVKALEKSFELGNKLEPERKIQLAKA 120

  Fly   302 IGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPG 366
            :|:...:|.:||.||||:|    |.|...|..|::.....:..::|.|....:..:.....:...
plant   121 LGMQPRQIAIWFQNRRARW----KTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVMALKN 181

  Fly   367 IVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYS 431
            ...:..|:.:|.:.|..||      ||         :|..||:   :....||..:.:..||:..
plant   182 KECNEGNIVKREAEASWSN------NG---------STENSSD---INLEMPRETITTHVNTIKD 228

  Fly   432 SIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRN-------TACNPS 489
            ..|..|.:.|                         ||         ..||:|       :.||..
plant   229 LFPSSIRSSA-------------------------HD---------DDHHQNHEIVQEESLCNMF 259

  Fly   490 AAHQQPPQHGVYTNSSP 506
            ....:....|.:..|.|
plant   260 NGIDETTPAGYWAWSDP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 28/114 (25%)
Homeobox 269..322 CDD:395001 18/52 (35%)
HB20NP_186771.1 HOX 87..140 CDD:197696 21/63 (33%)
HALZ 142..183 CDD:280364 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.