| Sequence 1: | NP_001368990.1 | Gene: | toy / 43833 | FlyBaseID: | FBgn0019650 | Length: | 655 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_179445.1 | Gene: | HB21 / 816370 | AraportID: | AT2G18550 | Length: | 220 | Species: | Arabidopsis thaliana |
| Alignment Length: | 139 | Identity: | 39/139 - (28%) |
|---|---|---|---|
| Similarity: | 60/139 - (43%) | Gaps: | 49/139 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 262 KRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRRE--- 323
Fly 324 ---------------EKMRTQ-----------------RRSADTVDGSGRTSTANNPSGTTASSS 356
Fly 357 VATSNNSTP 365 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| toy | NP_001368990.1 | PAX | 29..153 | CDD:128645 | |
| COG5576 | <253..368 | CDD:227863 | 39/139 (28%) | ||
| Homeodomain | 267..322 | CDD:459649 | 21/54 (39%) | ||
| HB21 | NP_179445.1 | HOX | 61..114 | CDD:197696 | 24/58 (41%) |
| Blue background indicates that the domain is not in the aligned region. | |||||