DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HB21

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:139 Identity:39/139 - (28%)
Similarity:60/139 - (43%) Gaps:49/139 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 KRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRRE--- 323
            ||||       |:||:..||..||..|..:...::|||.::||...::.|||.||||:|:.:   
plant    62 KRKL-------SDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVE 119

  Fly   324 ---------------EKMRTQ-----------------RRSADTVDGSGRTSTANNPSGTTASSS 356
                           ||.|..                 :|.|..|:|    :.:|:|   .:||.
plant   120 DEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRVEG----TLSNSP---ISSSV 177

  Fly   357 VATSNNSTP 365
            ...:|::||
plant   178 TIEANHTTP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 39/139 (28%)
Homeodomain 267..322 CDD:459649 21/54 (39%)
HB21NP_179445.1 HOX 61..114 CDD:197696 24/58 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.