DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Rhox13

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:193 Identity:49/193 - (25%)
Similarity:78/193 - (40%) Gaps:40/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 NGQTGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDS--T 240
            |.:....|...::|..|...:..|.:.|.|..:..|......|::.|.....|....:..||  :
Mouse    21 NAEAQAGAMAATSTEEAPGAVEVAQAAVASSHDSGGAIGCATVKESESDSESESDSESESDSSDS 85

  Fly   241 SDGNSEHNSSGDEDSQ---------------------------------MRLRLKRKLQRNRT-- 270
            ||.:.:.:|:.|||:.                                 .|.|..|:..|.|.  
Mouse    86 SDESDDDSSTSDEDTSDPEEAAAPSVAAVAAAAAPPTVPAAAAIQIPGPYRYRPPRRHVRRRRRG 150

  Fly   271 ---SFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
               .|:..|::.:|..||.|.|||:..|..||..:.:||.:::|||:|||||.|:.|:....|
Mouse   151 PPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIERREMLR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 32/116 (28%)
Homeodomain 267..322 CDD:459649 24/59 (41%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 14/68 (21%)
Homeodomain 155..205 CDD:459649 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.