DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pitx1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001035436.3 Gene:pitx1 / 678598 ZFINID:ZDB-GENE-060421-3623 Length:285 Species:Danio rerio


Alignment Length:333 Identity:90/333 - (27%)
Similarity:132/333 - (39%) Gaps:83/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LPPAASVVTSP-ANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRL 261
            ||.:||..... .|.|.::  .|.:..|.:.|||       ..:.|||::...            
Zfish    11 LPRSASSTRETLENTSSES--SDTEAAEKERSVE-------QRSDDGNADDPK------------ 54

  Fly   262 KRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKM 326
            |:|.:|.||.|:::|:..||..|:|..|||:..||.:|....|.|||::|||.|||||||:.|  
Zfish    55 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE-- 117

  Fly   327 RTQRRS-------------ADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERT 378
            |.|:..             ....|....|.|.||          .|:...||..:::.......:
Zfish   118 RNQQMDLCKNSYLPQFSGLMQPYDDVYPTYTYNN----------WTNKGLTPAPLSTKNFTFFNS 172

  Fly   379 SSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAEN 443
            .|.|.|.|:..|.:..:.:...:...|:         |.|.:| .:|.|.:            .|
Zfish   173 MSPLTSQSMFSAPSSISSMSMASGMGHS---------AVPGMP-TTGLNNI------------GN 215

  Fly   444 YNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAA-----HQQPPQHGVYTN 503
            .| .:|..|.:........||  ..|:   |||  :.:|:| ||.|.|     .:|.|..|....
Zfish   216 LN-GIGGSTINPAMSSSTCPY--GPPV---SPY--SVYRDT-CNSSLATLRLKSKQHPSFGYSGL 271

  Fly   504 SSPMPSSN 511
            .||..|.|
Zfish   272 QSPGSSLN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 42/127 (33%)
Homeobox 269..322 CDD:395001 27/52 (52%)
pitx1NP_001035436.3 COG5576 8..>126 CDD:227863 48/137 (35%)
Homeobox 62..114 CDD:278475 26/51 (51%)
OAR 247..263 CDD:281777 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.