DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pax1b

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_700877.6 Gene:pax1b / 572108 ZFINID:ZDB-GENE-060503-372 Length:340 Species:Danio rerio


Alignment Length:319 Identity:117/319 - (36%)
Similarity:163/319 - (51%) Gaps:76/319 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIG 97
            :||||||:|||||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.|||
Zfish    10 VNQLGGVFVNGRPLPNAIRIRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIG 74

  Fly    98 GSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQ 162
            ||||||.|..||:.|.|||:..|.|||||||||||::.||:..|:||||||:|:|||......|.
Zfish    75 GSKPRVTTPNVVKSIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLSQP 139

  Fly   163 AQQQNES-----VYEKLRMFNGQTGGWAWYPS--NTTTAHLTLPPAASVVTS------------- 207
            :|..:::     .|..:..::        ||:  :.|.:.|..|||.||..|             
Zfish   140 SQYDSKTSPPQISYNPVYPYS--------YPNTMSPTGSKLGSPPAVSVSLSRAWPSVHTVSNIL 196

  Fly   208 -------PANLSG----QADRDD-----------------VQKRELQFSVEVSHTNS-------- 236
                   ||.::|    |...:|                 :.|..|:..::.:..:|        
Zfish   197 GIRAFMDPAAIAGSESYQPKMEDWTGVNRPSFPSVHGVNGIDKPPLESDIKYTQASSNLSGYVPA 261

  Fly   237 --HDSTSD-------GNSEH---NSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKE 283
              :.:|:.       ||..|   .|:|.........::.....:..||.|...:::|::
Zfish   262 CAYSATNQYGVYGGHGNYGHWQSQSAGLSHPNTGTMIQSPNLHSALSFKNTSREAVERK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 83/119 (70%)
COG5576 <253..368 CDD:227863 4/31 (13%)
Homeobox 269..322 CDD:395001 4/15 (27%)
pax1bXP_700877.6 PAX 6..133 CDD:238076 86/122 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.