DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and PAX9

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens


Alignment Length:268 Identity:113/268 - (42%)
Similarity:146/268 - (54%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIG 97
            :||||||:|||||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.|||
Human     8 VNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIG 72

  Fly    98 GSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLR----NLASQ 158
            ||||||.|..||:.|..||:..|.|||||||||||::.||:..|:||||||:|:||    |||.|
Human    73 GSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQ 137

  Fly   159 KEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKR 223
            ....:.:|::...:....:|....    |||..|.|...:|....|...|.              
Human   138 GHYDSYKQHQPTPQPALPYNHIYS----YPSPITAAAAKVPTPPGVPAIPG-------------- 184

  Fly   224 ELQFSVEVSHT--NSH------------DSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSN 274
                ||.:..|  :||            |..||.:..|:...:|.|.:.       :.|..:.:.
Human   185 ----SVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLG-------RNNFPAAAP 238

  Fly   275 EQIDSLEK 282
            ..::.|||
Human   239 HAVNGLEK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 82/119 (69%)
COG5576 <253..368 CDD:227863 6/30 (20%)
Homeobox 269..322 CDD:395001 3/14 (21%)
PAX9NP_001359005.1 PAX 6..131 CDD:238076 84/122 (69%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63 39/54 (72%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 29/47 (62%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.