DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Hoxb5

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:333 Identity:70/333 - (21%)
Similarity:112/333 - (33%) Gaps:118/333 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIG 97
            :|...|.|.||   ||                   .::|...:|  |.:.|.|.:..::...:.|
  Rat     6 VNSFSGRYPNG---PD-------------------YQLLNYGSG--SSLSGSYRDPAAMHTGSYG 46

  Fly    98 GSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQ 162
                                     :.:...|..::....:|.:..:|...:|...  ||.:|.:
  Rat    47 -------------------------YNYNGMDLSVNRSSASSSHFGAVGESSRAFP--ASAQEPR 84

  Fly   163 AQQQNESVY----EKLRMFNGQTGG---WAWYPSNTTT------------------------AHL 196
            .:|...|..    |.|...||.:.|   .|..||:..|                        :.|
  Rat    85 FRQATSSCSLSSPESLPCTNGDSHGAKPSASSPSDQATPASSSANFTEIDEASASSEPEEAASQL 149

  Fly   197 TLPPAA-----SVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTS-DGNSEHNSSGDEDS 255
            :.|..|     .:.||.|...||..:.....|:|..        |||.|. ||            
  Rat   150 SSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHI--------SHDMTGPDG------------ 194

  Fly   256 QMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKW 320
                      :|.||:::..|...|||||....|.....|..:|..:.|.|.:|::||.|||.||
  Rat   195 ----------KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW 249

  Fly   321 RREEKMRT 328
            :::.|:::
  Rat   250 KKDNKLKS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 17/119 (14%)
COG5576 <253..368 CDD:227863 23/76 (30%)
Homeobox 269..322 CDD:395001 21/52 (40%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906 22/105 (21%)
Homeobox 198..251 CDD:365835 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.