DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pitx1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001007500.1 Gene:pitx1 / 493226 XenbaseID:XB-GENE-485441 Length:305 Species:Xenopus tropicalis


Alignment Length:334 Identity:95/334 - (28%)
Similarity:138/334 - (41%) Gaps:78/334 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 PANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSE------------HNSSGDEDSQMRLR 260
            |.:|..|...|......||.|.|......:.::...::|            .:.:||:.::    
 Frog    14 PESLRPQPSHDMATSFHLQRSSEARDPMDNSASESSDTEIAEKERSGEPKGEDGNGDDPTK---- 74

  Fly   261 LKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEK 325
             |:|.:|.||.|:::|:..||..|:|..|||:..||.:|....|.|||::|||.|||||||:.| 
 Frog    75 -KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEARVRVWFKNRRAKWRKRE- 137

  Fly   326 MRTQR----RSADTVDGSGRTST-----ANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSA 381
             |.|:    ::......||....     |..|....|:.|:      ||..::        |.|.
 Frog   138 -RNQQMDLCKNGYVPQFSGLMQPYDEMYAGYPYNNWATKSL------TPAPLS--------TKSF 187

  Fly   382 LVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYN- 445
            ...||:...|: .::..|.::.:..|..|.....|.|.:| ||..|.:            .|.| 
 Frog   188 TFFNSMSPLSS-QSMFSGPSSISSMSMPSSMGHSAVPGMP-NSSLNNI------------NNLNN 238

  Fly   446 ---SSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAA--HQQPPQHGVYTNS- 504
               |||.|...|     .|.||  ..|   ||||..  :|:| ||.|.|  ..:..||..:..| 
 Frog   239 ISSSSLNSAMSS-----TACPY--GPP---GSPYTV--YRDT-CNSSLASLRLKSKQHSTFGYSS 290

  Fly   505 --SPMPSSN 511
              ||..|.|
 Frog   291 LQSPASSLN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 42/123 (34%)
Homeobox 269..322 CDD:395001 27/52 (52%)
pitx1NP_001007500.1 Homeobox 82..135 CDD:365835 27/52 (52%)
OAR 267..285 CDD:367680 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.