DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and lhx6a

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001004015.1 Gene:lhx6a / 445565 ZFINID:ZDB-GENE-041025-1 Length:375 Species:Danio rerio


Alignment Length:178 Identity:45/178 - (25%)
Similarity:71/178 - (39%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNR 316
            ::|||     .:..:|.||||:.||:..::.:|.:.:.||....::|||..||....|||||.|.
Zfish   238 EQDSQ-----PKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNC 297

  Fly   317 RAKWRREEKMRTQRRSADTVDGSGRTSTA------NNPSGTTASSSVATSNNSTPGIVNSAINVA 375
            ||   |.:|...|...........|...:      .:|.|:...:.:...:    |.::|     
Zfish   298 RA---RHKKHTPQHNGPPQAHPQARMPPSLPDELHYSPFGSPERARMVALH----GYIDS----- 350

  Fly   376 ERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLN 423
             ...|.|.:.|||.          :|.|             .|:|||:
Zfish   351 -HPFSVLTTQSLPH----------QAMT-------------LPQLPLS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/120 (28%)
Homeobox 269..322 CDD:395001 22/52 (42%)
lhx6aNP_001004015.1 LIM1_Lhx6 97..150 CDD:188766
LIM2_Lhx6 158..212 CDD:188768
Homeobox 250..302 CDD:278475 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.