DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and LHX8

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_016856805.1 Gene:LHX8 / 431707 HGNCID:28838 Length:363 Species:Homo sapiens


Alignment Length:142 Identity:37/142 - (26%)
Similarity:61/142 - (42%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
            :|.||||:.:|:..::.:|.:.:.||....::||::.||....|||||.|.||:.::.       
Human   216 KRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKH------- 273

  Fly   331 RSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPT 395
                         .:.|.|.:|..::|..|..|.|       .:.|...||.|    |:.....|
Human   274 -------------VSPNHSSSTPVTAVPPSRLSPP-------MLEEMAYSAYV----PQDGTMLT 314

  Fly   396 VLGGEANTTHTS 407
            .|....:.||.:
Human   315 ALHSYMDDTHAA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 28/101 (28%)
Homeobox 269..322 CDD:395001 20/52 (38%)
LHX8XP_016856805.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.