DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pitx3

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_991238.1 Gene:pitx3 / 402974 ZFINID:ZDB-GENE-041229-4 Length:293 Species:Danio rerio


Alignment Length:295 Identity:88/295 - (29%)
Similarity:130/295 - (44%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 DVQKRELQFSVEVSHTNSHD------STSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQI 277
            |.:.|....|:..|.|..||      ..||....|.:..||.:.....||:|.:|.||.|:::|:
Zfish     8 DSEARSPALSLSDSGTPQHDPGCKGQDNSDTEKSHQNHTDESNPEDGSLKKKQRRQRTHFTSQQL 72

  Fly   278 DSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGR- 341
            ..||..|:|..|||:..||.:|....|.|||::|||.|||||||:.|:   .:::....:|.|. 
Zfish    73 QELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRER---NQQAELCKNGFGAQ 134

  Fly   342 ------------TSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVS--NSLPE--- 389
                        :..:.|...|.:.:|...|..|.| ..|| :||:..:|..:.|  :|:|.   
Zfish   135 FNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFP-FFNS-MNVSPLSSQPMFSPPSSIPSMNM 197

  Fly   390 -ASNGPTVLGGEANT------THTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENY--- 444
             :|..|:.:.|...:      ...:..||.|..||            .|:...|.||.|..|   
Zfish   198 ASSMVPSAVAGVPGSGLNNLGNLNNLNSPTLNSAA------------VSAAACPYATTAGPYMYR 250

  Fly   445 ---NSSLGSMTPSCLQQRD-AYPYMFHDPLSLGSP 475
               ||||.|:.....|..: |||.: .:|:|..||
Zfish   251 DTCNSSLASLRLKAKQHANFAYPAV-QNPVSNLSP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 42/127 (33%)
Homeobox 269..322 CDD:395001 27/52 (52%)
pitx3NP_991238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 19/60 (32%)
Cnd2 18..>79 CDD:303063 19/60 (32%)
Homeobox 64..116 CDD:278475 26/51 (51%)
OAR 251..268 CDD:281777 6/16 (38%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 255..268 5/12 (42%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O35160 260..264 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.