DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and shox2

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_957490.1 Gene:shox2 / 394171 ZFINID:ZDB-GENE-040426-1457 Length:299 Species:Danio rerio


Alignment Length:416 Identity:92/416 - (22%)
Similarity:143/416 - (34%) Gaps:176/416 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VTSPANLSGQADRDDVQK-----------REL-QFSVEVSHTNSHDSTSDGNSEHNSSGDE---- 253
            |.:..:||...:|:::..           ||. ..:.|.|..:|....:|||::.....::    
Zfish    34 VRNRESLSADPNREEISSITRSGVRSSPVREADMLASERSRDSSSPKLTDGNTDMKERKEDCKPL 98

  Fly   254 DSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRA 318
            :.:.:.::|::  |:||:|:.||::.||:.|:.|||||.|.||.|:.::||.|||:||||.||||
Zfish    99 EDETQTKIKQR--RSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRA 161

  Fly   319 KWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALV 383
            |.|::|                                                           
Zfish   162 KCRKQE----------------------------------------------------------- 167

  Fly   384 SNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSL 448
             |.|.:.     ||.|.|:.......:|.:...|.|:|.                          
Zfish   168 -NQLHKG-----VLIGAASQFEACRVAPYVNVGALRMPF-------------------------- 200

  Fly   449 GSMTPSCLQQRDAY----PYMF--HDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSSPM 507
                     |:|::    |:.|  ...|.|.|....|||.        .|.....|..|. ..|.
Zfish   201 ---------QQDSHCNVPPFSFQVQAQLQLDSAVAHAHHH--------LHSHLAAHAPYM-MFPA 247

  Fly   508 PSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQXSSIFGSPLDHLS--KATAAAIIAAQAAE 570
            |.                                      ||.||..|:  .|:||:::||.||.
Zfish   248 PP--------------------------------------FGLPLATLAAESASAASVVAAAAAA 274

  Fly   571 KSHKHRKEHSIVSIHTTKRKKNPPSL 596
            |:  ..|..||..:. .|.||:..:|
Zfish   275 KT--TNKNSSIADLR-LKAKKHAAAL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 35/118 (30%)
Homeobox 269..322 CDD:395001 31/52 (60%)
shox2NP_957490.1 Homeobox 111..164 CDD:278475 31/52 (60%)
OAR 278..294 CDD:281777 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.