| Sequence 1: | NP_001368990.1 | Gene: | toy / 43833 | FlyBaseID: | FBgn0019650 | Length: | 655 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_957134.1 | Gene: | pdlim7 / 393813 | ZFINID: | ZDB-GENE-040426-2092 | Length: | 419 | Species: | Danio rerio |
| Alignment Length: | 236 | Identity: | 46/236 - (19%) |
|---|---|---|---|
| Similarity: | 75/236 - (31%) | Gaps: | 87/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 348 PSGTTASSSVATSNNSTPGIVNSAINV----AERTSSALVSNSLPEASNGPTV--------LGGE 400
Fly 401 ANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGS-------------MT 452
Fly 453 PSCLQQRDAY------------PYMFHD--------PLSLG----SPYVS------AHHRNTACN 487
Fly 488 PSAAHQQPPQHGVYTNSSPMPSSN-TGVISAGVSVPVQIST 527 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| toy | NP_001368990.1 | PAX | 29..153 | CDD:128645 | |
| COG5576 | <253..368 | CDD:227863 | 5/19 (26%) | ||
| Homeobox | 269..322 | CDD:395001 | |||
| pdlim7 | NP_957134.1 | PDZ_signaling | 3..81 | CDD:238492 | 9/53 (17%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 174..232 | 14/65 (22%) | |||
| LIM1_Enigma | 244..295 | CDD:188836 | |||
| LIM2_Enigma | 303..354 | CDD:188840 | |||
| LIM3_Enigma | 362..416 | CDD:188842 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||