DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Awh

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:170 Identity:46/170 - (27%)
Similarity:71/170 - (41%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 TNSHDSTSDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERL 298
            |.|.|...||:..|              |.|.:|.||:|:.||:..|:..|:....||....||:
  Fly   131 TTSSDEGCDGDGYH--------------KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERI 181

  Fly   299 ADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRT------------STANNP--- 348
            |...||.:...||||.|.||  |:::.:...:......:||...            :.|.||   
  Fly   182 ASVTGLSKRVTQVWFQNSRA--RQKKHIHAGKNKIREPEGSSFARHINLQLTYSFQNNAQNPMHL 244

  Fly   349 SGTTA-------SSSVATSNNSTPGIVNSAINVAERTSSA 381
            :|:.|       ||....|.:|:...:.|.:.: |::|.|
  Fly   245 NGSKAGLYPTHESSMDELSQDSSVHCMPSEVXL-EQSSPA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 36/136 (26%)
Homeobox 269..322 CDD:395001 21/52 (40%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.