DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Gsc

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:204 Identity:72/204 - (35%)
Similarity:98/204 - (48%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GWAWYPSNTTTAHLTLPP----AASV-----VTSPANLSGQADRDDVQKRELQFSVEVSHTNSHD 238
            |:|..||:...|:....|    ||:|     ....|::||.|             ..:|....|.
  Fly   255 GFAASPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAA-------------AGLSGHGHHP 306

  Fly   239 STSDGNSEHNSSG-DEDSQMRLR-------LKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFAR 295
            ....|:..|...| ....|..|.       .||| :|:||.|:.||::.||..|::||||||..|
  Fly   307 HHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLR 370

  Fly   296 ERLADKIGLPEARIQVWFSNRRAKWR---REEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSV 357
            |:||.|:.|.|.|::|||.|||||||   |||:.|. |:..:...||....|.|:.||||:|:..
  Fly   371 EQLALKVDLKEERVEVWFKNRRAKWRKQKREEQERL-RKLQEEQCGSTTNGTTNSSSGTTSSTGN 434

  Fly   358 ATSNNSTPG 366
            .:.....||
  Fly   435 GSLTVKCPG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 54/124 (44%)
Homeobox 269..322 CDD:395001 32/55 (58%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.