DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and sdcbp2

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_997856.1 Gene:sdcbp2 / 325004 ZFINID:ZDB-GENE-030131-3727 Length:299 Species:Danio rerio


Alignment Length:306 Identity:60/306 - (19%)
Similarity:99/306 - (32%) Gaps:112/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 VLGGEANTTHTSSESPPL-------QPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTP 453
            |:..::...:.:|.:|.:       |||...:|    .:|:|.::.:            ||.   
Zfish    15 VIRAQSQFANATSSTPAITQGAYQPQPATQGMP----SSTLYPNLEE------------LGD--- 60

  Fly   454 SCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGV---- 514
                      ||   .|||.|..|   .||.|..|.|.....|. .|.....|:..::.|:    
Zfish    61 ----------YM---GLSLNSDEV---QRNLALVPVATQVAVPS-SVGGMVRPVTGADMGIRRAE 108

  Fly   515 ------------------------ISAGVSVPVQISTQNVSDLTGSNYWP---RLQXSSIFGSPL 552
                                    |..||.|.: :...:.:.|.|..:..   ::...::.|...
Zfish   109 IRPGLREVILCKDQEGKVGLRLRDIDNGVFVQL-VQANSPAALAGLRFGDQVLQINGQNVAGWNS 172

  Fly   553 DHLSKATAAAIIAAQAAEKSHKHRKEHSIVSIHTTKRKKNPPSLKRQTTCCSSRYLNMTFGAGKD 617
            |...||..||  |.|..|...:.|.....:::|..                ||.::...|.:|:.
Zfish   173 DKAHKALKAA--AEQRIELIVRDRPFQRTITMHKD----------------SSGHVGFIFKSGRI 219

  Fly   618 VDVV-----IGQGLIVSLTPH----ISGKPELFGSPNVNYHQDFQV 654
            ..:|     ...||   ||.|    |:|:       ||...:|.|:
Zfish   220 TSLVKDGSAARNGL---LTEHYICEINGQ-------NVIGLKDTQI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
sdcbp2NP_997856.1 PDZ_signaling 113..>173 CDD:238492 7/60 (12%)
PDZ_signaling 198..270 CDD:238492 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.