DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HOXB8

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:203 Identity:50/203 - (24%)
Similarity:82/203 - (40%) Gaps:46/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 MFNGQTGGWAWYPSN-----------TTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSV 229
            ::...:||...:||.           :|..:...|.|.:....|.|..|.   |.:|::.| |..
Human    39 VYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGY---DPLQRQSL-FGA 99

  Fly   230 E----VSHTNSHDSTSDGNSEHNSSGDEDSQ--------MRLRLKRKLQRNRTSFSNEQIDSLEK 282
            :    |.:.:...:.:.|..| .:.|.|.|.        ||.:.....:|.|.::|..|...|||
Human   100 QDPDLVQYADCKLAAASGLGE-EAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEK 163

  Fly   283 EFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRRE----------------EKMRTQR- 330
            ||....|.....|..::..:||.|.::::||.|||.||::|                ||.:.:| 
Human   164 EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERA 228

  Fly   331 -RSADTVD 337
             .:||..|
Human   229 PEAADEGD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 32/111 (29%)
Homeobox 269..322 CDD:395001 20/52 (38%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 20/52 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.