DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and HOXA3

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:408 Identity:94/408 - (23%)
Similarity:138/408 - (33%) Gaps:129/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEV----------SHTNSHDSTSD 242
            |:.|..|    ||..|..:.|.|.|......:..|..|..|..|          |..|:...||.
Human   112 PAPTPAA----PPPPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSS 172

  Fly   243 GNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEA 307
            .:|..:.:||:....:...||.    ||::::.|:..|||||....|.....|..:|:.:.|.|.
Human   173 SSSGESCAGDKSPPGQASSKRA----RTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTER 233

  Fly   308 RIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAI 372
            :|::||.|||.|:::::|            |.|..:::...|                       
Human   234 QIKIWFQNRRMKYKKDQK------------GKGMLTSSGGQS----------------------- 263

  Fly   373 NVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQ-- 435
                           |..|..|...||..|:.|:...|.|.:|.:|         ..:|..||  
Human   264 ---------------PSRSPVPPGAGGYLNSMHSLVNSVPYEPQSP---------PPFSKPPQGT 304

  Fly   436 ---PIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAA---HQQ 494
               |.|    :|.:||    |||                  :|......|.||....|.   ...
Human   305 YGLPPA----SYPASL----PSC------------------APPPPPQKRYTAAGAGAGGTPDYD 343

  Fly   495 PPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQXSSIFGSPLDHLSKAT 559
            |..||:..|.    |..|..|...   ||.:....|..::.|.       .::||  |.||..|.
Human   344 PHAHGLQGNG----SYGTPHIQGS---PVFVGGSYVEPMSNSG-------PALFG--LTHLPHAA 392

  Fly   560 AAAIIAAQAAE--KSHKH 575
            :.|:....|..  ..|.|
Human   393 SGAMDYGGAGPLGSGHHH 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 26/114 (23%)
Homeobox 269..322 CDD:395001 20/52 (38%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 11/38 (29%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 9/40 (23%)
Homeobox 195..248 CDD:395001 20/52 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 31/175 (18%)
DUF4074 378..441 CDD:404218 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.