DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and gsc

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_571092.1 Gene:gsc / 30212 ZFINID:ZDB-GENE-980528-2060 Length:240 Species:Danio rerio


Alignment Length:103 Identity:43/103 - (41%)
Similarity:64/103 - (62%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAK 319
            :|:..|.||   |:||.|::||:::||..|:.|.||||..||:||.|:.|.|.:::|||.|||||
Zfish   139 NQLHCRRKR---RHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAK 200

  Fly   320 WRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSV 357
            |||:     :|.|::..:.|.:.    |.|..|.|..:
Zfish   201 WRRQ-----KRSSSEESENSQKW----NKSTKTTSEKI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 43/103 (42%)
Homeobox 269..322 CDD:395001 29/52 (56%)
gscNP_571092.1 Homeobox 149..202 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..240 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.