DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and dharma

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:62 Identity:27/62 - (43%)
Similarity:37/62 - (59%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 KRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRRE 323
            :|...|.||.|::.|.:.||:.|..|.||.|..|..||...||.|..::|||.||||:.:|:
Zfish   112 QRPRGRIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTGLSEETVRVWFKNRRARRKRQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 27/62 (44%)
Homeodomain 267..322 CDD:459649 25/54 (46%)
dharmaNP_571054.1 Homeodomain 117..172 CDD:459649 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.