DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and mixl1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio


Alignment Length:339 Identity:79/339 - (23%)
Similarity:119/339 - (35%) Gaps:120/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
            :|.||:|:.:|||.|||.:..|.|||::.||:|....||||:||||||.|||||.||:..:....
Zfish    59 RRKRTNFTQQQIDVLEKVYLDTKYPDIYLREKLEALTGLPESRIQVWFQNRRAKSRRQVGISIPN 123

  Fly   331 RSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPT 395
            ::      ||...|.||    .......|..|      :|.:...:|||:....:...:..|   
Zfish   124 KT------SGNILTPNN----LLMHQFTTHQN------HSGLENLQRTSTFTADSFHQQLIN--- 169

  Fly   396 VLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD 460
                       |||..              .:|:...|..|              .|..|:..|.
Zfish   170 -----------SSEEK--------------ISTIKGDIYDP--------------TTIPCMFSRT 195

  Fly   461 AYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSS-------------------- 505
            .     .:|       :...|.:.....|...|.|.:|..:|:|:                    
Zfish   196 Q-----ENP-------IKTDHLSVVVPRSYTQQYPKEHEQFTHSANHAKSTMKQFLVEYDNFPPN 248

  Fly   506 ------------PMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQXSSIFGSPLDHLSKA 558
                        |:||.:..::|:.....:..|.||:|..|....:                  |
Zfish   249 KTIGPEMKVVIPPLPSQSNFMMSSSSPKHIACSVQNMSVQTQPELF------------------A 295

  Fly   559 TAAAIIAAQAAEKS 572
            |.:.|.|::|.|.|
Zfish   296 TFSPIRASEAVEFS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 41/101 (41%)
Homeobox 269..322 CDD:395001 31/52 (60%)
mixl1NP_571015.3 Homeobox 61..114 CDD:278475 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.