DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and sebox

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:261 Identity:74/261 - (28%)
Similarity:107/261 - (40%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 VQKRELQFSVE-VSHTNSHDSTSDGNSEHNSSGDE-DSQMRLRLKRKLQRNRTSFSNEQIDSLEK 282
            |||..::...: :.:||....| |..::|..|..| |....:..:||  |.||.||..|:..||:
Zfish    14 VQKINMETESDFIFNTNMLQFT-DVTTKHMLSSPELDRTGHVEGQRK--RKRTIFSRAQLSELER 75

  Fly   283 EFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRT--QRRSADTVDGSGRTSTA 345
            .|..|.|||:..|||||....|||::|||||.||||:..:.:|:.|  .|||    .....|..|
Zfish    76 AFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMKSKKLITPVSRRS----PAKDCTFPA 136

  Fly   346 NNPSGTTASSSVATSN--NSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSS 408
            .:|......|..|..:  :....::..|:|              |...|                
Zfish   137 THPDLNLEQSPEANKSLRHHQQSLIRQALN--------------PWPQN---------------- 171

  Fly   409 ESPPLQPAAPRL----------PLNSGFNTMYSS-IPQPIATMAENYNSSLGSMTPSCLQQRDAY 462
             .||:.|..|.:          |.:|.|::..|. |..|.    .|.:||:..|  :|..   |:
Zfish   172 -RPPISPDLPEILQWANRNSETPGDSSFSSCPSERIQHPF----PNQSSSVWQM--NCFA---AH 226

  Fly   463 P 463
            |
Zfish   227 P 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 44/119 (37%)
Homeobox 269..322 CDD:395001 29/52 (56%)
seboxNP_001306981.1 COG5576 13..159 CDD:227863 53/151 (35%)
Homeobox 61..112 CDD:278475 28/50 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.