DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Duxbl1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_899245.1 Gene:Duxbl1 / 278672 MGIID:1916048 Length:350 Species:Mus musculus


Alignment Length:293 Identity:70/293 - (23%)
Similarity:112/293 - (38%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 NSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVW 312
            :....|..|.:.|:| :.:|:||.|:..|.|.|.:.||:..:|.:..||:||.:.|:||:||.:|
Mouse    78 SEESQEQEQDKPRVK-EARRSRTHFTKFQTDILIEAFEKNRFPGIVTREKLAQQTGIPESRIHIW 141

  Fly   313 FSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANN---PSGTTASSSVATSNNSTPGIVNSAINV 374
            |.||||: ..:....||:.........|.|.....   ||.|..||:......|.|...|..:::
Mouse   142 FQNRRAR-HPDPGQNTQKTPHPPQSSQGPTQKTVGKLAPSKTLTSSASVILPLSPPHTPNGPLDL 205

  Fly   375 AERTSSALVSNSLPEASN----------------GPTVLGGE-------------ANTTHTSSES 410
            ::.....|...:|.::|.                .||...||             .|..|...||
Mouse   206 SKGRQKQLPGTTLLQSSQVVQQRSDDQNPNKGHLSPTTTPGEQGFHSQPPLQLLTQNRGHNPRES 270

  Fly   411 PPLQPAAPRL------PLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCL-------QQRDAY 462
            ..|  |.|||      |   ..|..:..:.|..::..::::...|||....:       ::.:.:
Mouse   271 GGL--AVPRLEDCTQVP---AVNQHFRKLDQNDSSFLQHWDEWFGSMLAEWMPDKEYWSEKAELH 330

  Fly   463 PYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQP 495
            |:             ....|..|.....|||.|
Mouse   331 PW-------------QVQLRQLASVSPQAHQTP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 40/117 (34%)
Homeobox 269..322 CDD:395001 24/52 (46%)
Duxbl1NP_899245.1 homeodomain 15..71 CDD:238039
HOX 95..149 CDD:197696 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.