DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and PDLIM3

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:197 Identity:44/197 - (22%)
Similarity:68/197 - (34%) Gaps:61/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTT 404
            ||:|..:.|||....     |..|||..|::.                      .|:..|:....
Human   130 GRSSGCSTPSGIDCG-----SGRSTPSSVSTV----------------------STICPGDLKVA 167

  Fly   405 HTSSESPPLQPAAPRLPL-NSGFNT---MYSSIPQPIATMAENYNSSLGSM------TPSCLQQR 459
            ...:.:.||:...|.:.: ::.|||   :||. ...:.|:....:::||..      |.|...:.
Human   168 AKLAPNIPLEMELPGVKIVHAQFNTPMQLYSD-DNIMETLQGQVSTALGETPLMSEPTASVPPES 231

  Fly   460 DAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAG---VSV 521
            |.| .|.||            :||   .|:    ||.|.|.:.....|....:....||   |..
Human   232 DVY-RMLHD------------NRN---EPT----QPRQSGSFRVLQGMVDDGSDDRPAGTRSVRA 276

  Fly   522 PV 523
            ||
Human   277 PV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 10/27 (37%)
Homeobox 269..322 CDD:395001
PDLIM3NP_055291.2 PDZ_signaling 2..80 CDD:238492
DUF4749 184..263 CDD:374237 23/99 (23%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.