Sequence 1: | NP_001368990.1 | Gene: | toy / 43833 | FlyBaseID: | FBgn0019650 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055291.2 | Gene: | PDLIM3 / 27295 | HGNCID: | 20767 | Length: | 364 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 68/197 - (34%) | Gaps: | 61/197 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 340 GRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTT 404
Fly 405 HTSSESPPLQPAAPRLPL-NSGFNT---MYSSIPQPIATMAENYNSSLGSM------TPSCLQQR 459
Fly 460 DAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAG---VSV 521
Fly 522 PV 523 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toy | NP_001368990.1 | PAX | 29..153 | CDD:128645 | |
COG5576 | <253..368 | CDD:227863 | 10/27 (37%) | ||
Homeobox | 269..322 | CDD:395001 | |||
PDLIM3 | NP_055291.2 | PDZ_signaling | 2..80 | CDD:238492 | |
DUF4749 | 184..263 | CDD:374237 | 23/99 (23%) | ||
LIM_ALP | 294..346 | CDD:188834 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |