DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Mixl1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_038757.1 Gene:Mixl1 / 27217 MGIID:1351322 Length:231 Species:Mus musculus


Alignment Length:194 Identity:60/194 - (30%)
Similarity:85/194 - (43%) Gaps:59/194 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
            :|.|||||:||:..||..|.:|.|||:..|||||....|||:||||||.|||||.||:.....|.
Mouse    87 RRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQP 151

  Fly   331 RSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASN--- 392
            .|      |.|....:.|:               ||           |.:..:...||..::   
Mouse   152 LS------SRRGVFLHCPA---------------PG-----------TEARCLKPQLPLEADVNH 184

  Fly   393 --GPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYN----SSLGS 450
              .|::.||...|:.:.|                 |.| |||:.:.|.:..:::.    |:||:
Mouse   185 VPDPSMTGGGVCTSGSQS-----------------FET-YSSLSEDIGSKLDSWEEHIFSALGN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 43/101 (43%)
Homeobox 269..322 CDD:395001 33/52 (63%)
Mixl1NP_038757.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..93 3/5 (60%)
Homeobox 89..142 CDD:278475 33/52 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.