DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and DUX1

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_036278.1 Gene:DUX1 / 26584 HGNCID:3079 Length:170 Species:Homo sapiens


Alignment Length:82 Identity:32/82 - (39%)
Similarity:45/82 - (54%) Gaps:15/82 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMR 327
            :|.:|.||:.:..|...|.:.||:..:|.:.|||.||.:.||||:|||:||.||||:.|.:    
Human    92 QKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQ---- 152

  Fly   328 TQRRSADTVDGSGRTST 344
                       |||..|
Human   153 -----------SGRAPT 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 32/82 (39%)
Homeodomain 267..322 CDD:459649 26/54 (48%)
DUX1NP_036278.1 Homeodomain 27..71 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..100 3/7 (43%)
Homeodomain 95..150 CDD:459649 26/54 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.