DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pxl1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:37/163 - (22%)
Similarity:59/163 - (36%) Gaps:49/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ECPSIFAWEIRDRLLS--EQVCNSDNIPSVSSI------------------------NRVLRNLA 156
            |.||: |:...|...|  |::.:..|.|.|.::                        ::.|..|.
pombe   121 ELPSL-AYSDDDEFPSSPEELNSHVNYPDVRNVYDCHTGLQPLVDHDCIEDRQKTFASKQLPTLP 184

  Fly   157 SQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQ 221
            .||..:...:..:    |..|:..... :.||..|.|:.|           |:|||   ..:..|
pombe   185 LQKSSKLSNRRPA----LHSFHSAPAN-SLYPLPTPTSQL-----------PSNLS---SNNLFQ 230

  Fly   222 KRELQFSVEVSHTNSHDSTSDGNSE---HNSSG 251
            ...|:.|:..|||::......||||   |:..|
pombe   231 SDSLKPSMVSSHTSTKPVLYRGNSEKSCHSCGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 10/60 (17%)
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
pxl1NP_596112.1 LIM 258..314 CDD:278823 2/6 (33%)
LIM 318..370 CDD:259829
LIM 378..428 CDD:259829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.