DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Gm4981

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:276 Identity:68/276 - (24%)
Similarity:100/276 - (36%) Gaps:75/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEK 325
            ::...:|..|..:..|...|.:.|||...|....||.||.:.||||..|..|..|:||  ||..:
Mouse     1 MRSSSRRPHTGLTLSQRRILAQAFERNPRPGCATREELALETGLPEDMIHTWLKNKRA--RRHRR 63

  Fly   326 MRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEA 390
            .|...:..|.:                 :|.|  |..:..|.|.....||:       .:|||:.
Mouse    64 GRPTAQDQDLL-----------------ASQV--SGGAPAGPVGRGHEVAQ-------ESSLPQE 102

  Fly   391 SNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSC 455
            ..|.|.:    :||.||     ..|:..|       .:..|.:.||.....:...:..|::.|..
Mouse   103 EAGSTGM----DTTSTS-----YSPSFCR-------ESQLSQVSQPRGAGQKEVPTQAGNVGPLE 151

  Fly   456 L---------QQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTNSSPMPSSN 511
            |         |.::..|    |||.|||            :|.|...:..|..:   .|...::|
Mouse   152 LLLDELQDEVQVKEHVP----DPLDLGS------------DPGAREPEGSQDSL---QSLDEAAN 197

  Fly   512 TGVISAGVSVPVQIST 527
            :|   ...|||...||
Mouse   198 SG---WHTSVPSISST 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 29/106 (27%)
Homeobox 269..322 CDD:395001 20/52 (38%)
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.