DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Prop1

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_032962.1 Gene:Prop1 / 19127 MGIID:109330 Length:223 Species:Mus musculus


Alignment Length:260 Identity:80/260 - (30%)
Similarity:104/260 - (40%) Gaps:97/260 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 STSDGNSE--HNSSGDEDSQMRLRLKR----KLQRNRTSFSNEQIDSLEKEFERTHYPDVFARER 297
            ||.|.:||  ...||.|..:.:|..:|    ..:|:||:|:..|::.||..|.|..|||::|||.
Mouse    34 STVDRSSEAYRRLSGTELGRPKLCPQRGRPHSRRRHRTTFNPAQLEQLESAFGRNQYPDIWAREG 98

  Fly   298 LADKIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNN 362
            ||...||.||||||||.|||||.|::|:                                     
Mouse    99 LAQDTGLSEARIQVWFQNRRAKQRKQER------------------------------------- 126

  Fly   363 STPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFN 427
                   |.:......|:|..|..|||:|..|...|           :||  |.||..|      
Mouse   127 -------SLLQPIAHLSTATFSGFLPESSAYPYTYG-----------TPP--PPAPCFP------ 165

  Fly   428 TMYS-SIPQPIATMAENYNSSLGSMTPSCLQQRDAYPY----------------MFHDPLSLGSP 475
            ..|| |:|...:|.|     || ::.|   |..|.||.                ||  ||||.:|
Mouse   166 HPYSHSLPSQPSTAA-----SL-ALPP---QPEDWYPTLHPAPTGHLPCPPPPPMF--PLSLETP 219

  Fly   476  475
            Mouse   220  219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 37/118 (31%)
Homeodomain 267..322 CDD:459649 32/54 (59%)
Prop1NP_032962.1 Homeodomain 67..123 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..223 20/63 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.