DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and npax-3

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_502006.2 Gene:npax-3 / 187848 WormBaseID:WBGene00011257 Length:205 Species:Caenorhabditis elegans


Alignment Length:109 Identity:35/109 - (32%)
Similarity:51/109 - (46%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKP--- 93
            |.|..|..|..||||....|.:|::|.::|.:...||:.|.:|:||||||:.|:..||.:.|   
 Worm    81 GTNLYGRPYCPGRPLSMEERTRIIQLHNNGMKVNAISKSLCISHGCVSKIISRFRATGVLLPACS 145

  Fly    94 ----------RAIGGSKPRVATTPVVQKIAD-----YKRECPSI 122
                      .::.||....:..||...:.|     |..|..||
 Worm   146 PEQRKSRKRKSSMEGSAMEQSFIPVFVSMQDANGNEYLNEYYSI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 35/109 (32%)
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
npax-3NP_502006.2 PAX 78..200 CDD:128645 35/109 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.