DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Pitx3

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:377 Identity:93/377 - (24%)
Similarity:144/377 - (38%) Gaps:110/377 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PPAASVVTSPANLSGQADRDDVQKR---ELQFSV--EVSHTNSHDSTSDGNS------EHNSSGD 252
            ||:..:            .|:::::   .::|.:  |....:...|.||..:      ||...|.
Mouse    70 PPSTEI------------EDEIKRQRPPSMEFGLLGEAEARSPALSLSDAGTPHPPLPEHGCKGQ 122

  Fly   253 EDSQMRL-------------RLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGL 304
            |.|....             .||:|.:|.||.|:::|:..||..|:|..|||:..||.:|....|
Mouse   123 EHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNL 187

  Fly   305 PEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRT----------------STANNPSGTTA 353
            .|||::|||.|||||||:.|  |:|:  |:...|....                |..|.|....|
Mouse   188 TEARVRVWFKNRRAKWRKRE--RSQQ--AELCKGGFAAPLGGLVPPYEEVYPGYSYGNWPPKALA 248

  Fly   354 SSSVATSNNSTPGIVNSAINVAERTS-------SALVSNSLPEASNGPTVLGGEANTTHTSSESP 411
            ....|   .:.|...|| :||....|       |::.::.:|.|:..|..:.|...........|
Mouse   249 PPLAA---KTFPFAFNS-VNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPP 309

  Fly   412 PLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPY 476
            .|.|||    ::||      ::..|.|:.|....::..|            ||::.||       
Mouse   310 GLAPAA----VSSG------AVSCPYASAAAAAAAAASS------------PYVYRDP------- 345

  Fly   477 VSAHHRNTACNPSAA--HQQPPQHGVYTNSS---PMPSSNTGVISAGVSVPV 523
                     ||.|.|  ..:..||..::..:   |.|::|.......|..||
Mouse   346 ---------CNSSLASLRLKAKQHASFSYPAVPGPPPAANLSPCQYAVERPV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 45/143 (31%)
Homeobox 269..322 CDD:395001 27/52 (52%)
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 27/52 (52%)
PTZ00395 <228..>322 CDD:185594 23/107 (21%)
OAR 344..361 CDD:367680 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.