DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Pitx1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus


Alignment Length:267 Identity:81/267 - (30%)
Similarity:111/267 - (41%) Gaps:66/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSN 315
            |.||...    |:|.:|.||.|:::|:..||..|:|..|||:..||.:|....|.|.|::|||.|
Mouse    80 GAEDPAK----KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKN 140

  Fly   316 RRAKWRREEKMRTQRRSADTVDG------SGRTS------TANNPSGTTASSSVATSNNSTPGIV 368
            ||||||:.|:    .:..|...|      ||...      .|.......|:.|:|.:..||....
Mouse   141 RRAKWRKRER----NQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT 201

  Fly   369 --NSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYS 431
              ||        .|.|.|.|:..|   |:.:   ::.|..||..|...|..|    |||.|    
Mouse   202 FFNS--------MSPLSSQSMFSA---PSSI---SSMTMPSSMGPGAVPGMP----NSGLN---- 244

  Fly   432 SIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAA--HQQ 494
                       |.|:..||...|.:.. .|.||.     :..|||  :.:|:| ||.|.|  ..:
Mouse   245 -----------NINNLTGSSLNSAMSP-GACPYG-----TPASPY--SVYRDT-CNSSLASLRLK 289

  Fly   495 PPQHGVY 501
            ..||..:
Mouse   290 SKQHSSF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 43/126 (34%)
Homeobox 269..322 CDD:395001 26/52 (50%)
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 10/27 (37%)
Homeobox 94..147 CDD:365835 26/52 (50%)
Interaction with PIT-1 151..280 41/170 (24%)
Forkhead_N 196..>275 CDD:369872 31/119 (26%)
OAR 277..294 CDD:367680 6/17 (35%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294 3/12 (25%)
Nuclear localization signal. /evidence=ECO:0000255 287..291 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.