Sequence 1: | NP_001368990.1 | Gene: | toy / 43833 | FlyBaseID: | FBgn0019650 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500513.1 | Gene: | pax-2 / 187062 | WormBaseID: | WBGene00003938 | Length: | 351 | Species: | Caenorhabditis elegans |
Alignment Length: | 276 | Identity: | 110/276 - (39%) |
---|---|---|---|
Similarity: | 148/276 - (53%) | Gaps: | 69/276 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 STAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGS 90
Fly 91 IKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRN- 154
Fly 155 ---------------------LASQKE-------QQAQQQNESVYEKLRMFNGQTGGWAWYPSNT 191
Fly 192 TTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGN----SEHNSS-- 250
Fly 251 --------GDEDSQMR 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toy | NP_001368990.1 | PAX | 29..153 | CDD:128645 | 81/123 (66%) |
COG5576 | <253..368 | CDD:227863 | 3/6 (50%) | ||
Homeobox | 269..322 | CDD:395001 | |||
pax-2 | NP_500513.1 | PAX | 91..215 | CDD:128645 | 81/123 (66%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45636 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |