DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and pax-2

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_500513.1 Gene:pax-2 / 187062 WormBaseID:WBGene00003938 Length:351 Species:Caenorhabditis elegans


Alignment Length:276 Identity:110/276 - (39%)
Similarity:148/276 - (53%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 STAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGS 90
            |...|:|:||||||:||||||||:.|.:|||::..|.|||||||.|:||:|||||||||||.|||
 Worm    88 SDGSHTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGS 152

  Fly    91 IKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRN- 154
            ::|..||||||:|||..||:.||.|||..|::||||||.:|:.:|:|..:|:||||||||::|| 
 Worm   153 VRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNK 217

  Fly   155 ---------------------LASQKE-------QQAQQQNESVYEKLRMFNGQTGGWAWYPSNT 191
                                 ..||.:       ||..||:.|| ::|:.|.        ..|..
 Worm   218 SFMAQLATPTSVTPSVARPSSATSQNQRSPPRGVQQHMQQSTSV-QQLQQFQ--------LTSAA 273

  Fly   192 TTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGN----SEHNSS-- 250
            |...|...||.::..:..:::|                 :..|..|.|..|..    |.|::.  
 Worm   274 TVNSLISRPAFAIPGTTHSING-----------------LLGTFPHSSLLDDKFTNLSTHSADMS 321

  Fly   251 --------GDEDSQMR 258
                    |:.|..||
 Worm   322 LVYPTGLVGEHDWAMR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 81/123 (66%)
COG5576 <253..368 CDD:227863 3/6 (50%)
Homeobox 269..322 CDD:395001
pax-2NP_500513.1 PAX 91..215 CDD:128645 81/123 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.