Sequence 1: | NP_001368990.1 | Gene: | toy / 43833 | FlyBaseID: | FBgn0019650 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006498974.1 | Gene: | Pax1 / 18503 | MGIID: | 97485 | Length: | 534 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 99/205 - (48%) |
---|---|---|---|
Similarity: | 126/205 - (61%) | Gaps: | 33/205 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 INQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIG 97
Fly 98 GSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRN----LASQ 158
Fly 159 KEQQAQQQ--------NESVYE------------KLRMFNGQTGGWAWYPSNTTTAHLTLPPAAS 203
Fly 204 VVTSPANLSG 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
toy | NP_001368990.1 | PAX | 29..153 | CDD:128645 | 83/119 (70%) |
COG5576 | <253..368 | CDD:227863 | |||
Homeobox | 269..322 | CDD:395001 | |||
Pax1 | XP_006498974.1 | PAX | 177..304 | CDD:238076 | 86/122 (70%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |