DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Pax1

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_006498974.1 Gene:Pax1 / 18503 MGIID:97485 Length:534 Species:Mus musculus


Alignment Length:205 Identity:99/205 - (48%)
Similarity:126/205 - (61%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIG 97
            :||||||:|||||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.|||
Mouse   181 VNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIG 245

  Fly    98 GSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRN----LASQ 158
            ||||||.|..||:.|.|||:..|.|||||||||||::.||:..|:||||||:|:|||    ||..
Mouse   246 GSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQP 310

  Fly   159 KEQQAQQQ--------NESVYE------------KLRMFNGQTGGWAWYPSNTTTAHLTLPPAAS 203
            ...:|.:|        ...:|:            |:....|..|         :..|:::|.:..
Mouse   311 GPYEASKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPG---------SAGHVSIPRSWP 366

  Fly   204 VVTSPANLSG 213
            ...|.:|:.|
Mouse   367 SAHSVSNILG 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 83/119 (70%)
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
Pax1XP_006498974.1 PAX 177..304 CDD:238076 86/122 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.