DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and npax-1

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_495533.2 Gene:npax-1 / 184779 WormBaseID:WBGene00017664 Length:176 Species:Caenorhabditis elegans


Alignment Length:162 Identity:50/162 - (30%)
Similarity:72/162 - (44%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MHGHPH------SSVGQ----------------STLFGCSTAGHS---GINQ------LGGVYVN 42
            :|.|.|      .|.|.                |..:..|:|..|   .||:      :|..|..
 Worm     5 IHQHTHFPVSTNGSTGSPPNNTLPPPIIPYSLLSAFYSLSSANISTSPEINEGEKVKAVGRSYNP 69

  Fly    43 GRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRV---A 104
            ||||....|:|||.|...|.|...|:|::.|::.|||||:.||..|||::||:...::.:.   |
 Worm    70 GRPLCLEDRKKIVRLYEEGCRVSHIARLIGVTHSCVSKIMSRYRRTGSVQPRSFRATENQENDNA 134

  Fly   105 TTPVVQKIADYKRECPSIFAWEIRDRLLSEQV 136
            |....|.....|:|.|..|:.|   |:||..:
 Worm   135 TWQQQQLKQQQKKEKPLPFSIE---RILSPDI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 42/120 (35%)
COG5576 <253..368 CDD:227863
Homeodomain 267..322 CDD:459649
npax-1NP_495533.2 HTH_ARSR 60..>122 CDD:481197 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.