DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and Sebox

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_032785.1 Gene:Sebox / 18292 MGIID:108012 Length:190 Species:Mus musculus


Alignment Length:194 Identity:53/194 - (27%)
Similarity:75/194 - (38%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEKMRTQR 330
            :|.||:||..|:..||:.|....|||:..||.||....||||:|||||.|||||..::.|     
Mouse    19 RRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKIQVWFQNRRAKRIKDRK----- 78

  Fly   331 RSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPT 395
                                              ||.:||.:.:...      |.|||:....|.
Mouse    79 ----------------------------------PGALNSRLELPPN------SCSLPDTPQLPW 103

  Fly   396 VLGGEANTTHTSSESPPLQPAAPRLP-----LNSGFNTMYSSIPQPIATM-AENYNSSLGSMTP 453
            ..|..::..|.:|.:.......|:..     |..|.:...:.:..|..|. |...:|||..:.|
Mouse   104 DPGTSSHPLHPTSSAQYTSACPPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLEQIVP 167

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 33/101 (33%)
Homeodomain 267..322 CDD:459649 30/54 (56%)