DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and npax-4

DIOPT Version :10

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001255346.1 Gene:npax-4 / 182466 WormBaseID:WBGene00007496 Length:202 Species:Caenorhabditis elegans


Alignment Length:122 Identity:42/122 - (34%)
Similarity:58/122 - (47%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGG 98
            |:.|..|::||||....||||||....|.:...|::.|.:::.||||:|.||.|||.|..:|.  
 Worm    80 NRYGRPYISGRPLLTCDRQKIVECYKKGMKKIHIAKQLGITHSCVSKVLRRYAETGEIVAKAC-- 142

  Fly    99 SKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDN-IPSVSSINRVLRN 154
               |.|:.           .||.  :.|..|....:.:  .|| |....||..:|||
 Worm   143 ---RTASC-----------SCPG--SAEEHDARYCKHL--QDNTIRLFFSIENLLRN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 39/119 (33%)
COG5576 <253..368 CDD:227863
Homeodomain 267..322 CDD:459649
npax-4NP_001255346.1 HTH_ARSR 79..>142 CDD:481197 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.