DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toy and egl-38

DIOPT Version :9

Sequence 1:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_501836.1 Gene:egl-38 / 177876 WormBaseID:WBGene00001204 Length:289 Species:Caenorhabditis elegans


Alignment Length:175 Identity:92/175 - (52%)
Similarity:119/175 - (68%) Gaps:14/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 STAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGS 90
            |...|:|:||||||:||||||.|:.|.:|||::..|.|||||||.|:||:|||||||||||.|||
 Worm    26 SDGSHTGVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGS 90

  Fly    91 IKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNL 155
            ::|..||||||:|||..||:.||.|||..|::||||||.:|:.:|:|..:|:||||||||::||.
 Worm    91 VRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVRNK 155

  Fly   156 ASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPP 200
            :...:..|.....|.              |..||:.|:.|...||
 Worm   156 SFMAQLAAPTSVTSS--------------AARPSSATSHHQRSPP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toyNP_001368990.1 PAX 29..153 CDD:128645 80/123 (65%)
COG5576 <253..368 CDD:227863
Homeobox 269..322 CDD:395001
egl-38NP_501836.1 PAX 29..153 CDD:128645 80/123 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.